DPCstruct | MC8426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 63 ± 2 aa |
| Standard deviation of domain lengths | 1.83 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1P847 | 1-61 | MNWDRIEGNWKQAKGKVKEQWGKLTDDHLDVIAGKRDQLAGKIQETYGISKDEAEKQVKDW |
| A0A0F6W5V0 | 1-64 | MTWDDIAARWRQLKGQVKTEFGKLDDDTFDAIGGDRERLVAALEEKYGYPKEHAVQRVDSWVSR |
| G7LSF3 | 35-99 | None |
| A0A6M4P5I4 | 26-90 | None |
| A0A7W0JDV3 | 1-64 | None |
| A0A090DW12 | 1-64 | None |
| A0A5C8IZ41 | 19-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.