DPCstruct | MC8425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 123 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849D1G2 | 20-141 | LEAKDISFSDEIMEMDGQLNFYINTDFNVDQIFGTHVETAENDDWLNVYANFDMKSRQVCDTLDIELHRGDGSEETLSYTLNAAEKE… |
| R5L0F2 | 2-116 | GDLTKNDIEVCDLEINDDGDGISAYLETLFDVDEKFGTNVNDDDDSWVNFYAEYFPESGELKCTYFVDRANGSDEHEYVPSANEKSL… |
| A0A1Y3R5C1 | 78-218 | None |
| A0A1Y3S1Z5 | 218-340 | None |
| A0A6I7GLF0 | 3-118 | None |
| A0A1Y4FF44 | 27-149 | None |
| A0A1Y4WM42 | 140-269 | None |
| A0A7X5L5I1 | 1-134 | None |
| A0A1Y4WF04 | 352-478 | None |
| A0A810QFJ1 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.