DPCstruct | MC8424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 225 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0116- CL0143 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S0VY56 | 411-617 | RVARATSPNGPYYDAQGNNMANVRGDRSAIAPYGVKLMGGFEFAGDYGYLAPGHQSSVYKPETGQYFLVFHTRFPNSGEFHQVRVHE… |
| A0A849CWH4 | 1-209 | MRLFRSKEVTGPYLDAAGNNSADSYRNNDSYGIKLIGNYKLTGTSVGYKAAGHNSALIDEDGQHYLIYHQRFDQGTEYHEVRVHQQF… |
| A0A6G8DD85 | 106-333 | None |
| R6PYN1 | 25-250 | None |
| A0A7X6MXF9 | 428-645 | None |
| A0A1I3C3F4 | 333-543 | None |
| I0X7I3 | 388-659 | None |
| A0A6L5X6M4 | 1-211 | None |
| A0A7X7VZX1 | 3-166 | None |
| A0A087CZC4 | 296-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.