DPCstruct | MC8422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 179 ± 20 aa |
| Standard deviation of domain lengths | 19.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6HXD1 | 323-507 | LPTYMWVSKAEQNLGNYLRFLSLQQVYWLRMAIQSELWNLSDAEYVMNRLMENPQDFQMAFKTFYGDENAKKLADLLTNHLTMVINY… |
| A9KQZ6 | 6-182 | YEFTRRQLDLSNELRDLWQQHVLWTRSFIISTAASLGDLEPVTKRLMRNPTDFGNLFRLFYGRQTALEFEDLFTQHLQLAGELVNAL… |
| A0A7W1A924 | 18-206 | None |
| A0A1G3XR97 | 35-249 | None |
| A0A429Y529 | 3-159 | None |
| A0A561PMW7 | 25-211 | None |
| A0A6J6DA82 | 23-243 | None |
| A0A2I0QSR2 | 151-337 | None |
| A0A7Z0W1W5 | 99-277 | None |
| A0A3E2N641 | 154-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.