DPCstruct | MC8421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 170 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4ABW8 | 154-326 | VNTSGGNLVPGGILSGYKGYSNGSLVTGTIPSKSAATITPSSVNQTITAGQYLSGTQTIQGDPDLISSNIRAGVNIFGVNGDTNVVN… |
| A0A2S6HUV9 | 14-206 | AGSDECTATSSEVLKGYTAITSDSDDEIVEGTLELTGDAADSQVLDKRTYYNKDARVKRTGNMPNCGAISTVLNAGGSYTIPAGYHN… |
| A0A220ML34 | 54-224 | None |
| A0A1Y4R5T8 | 1-217 | None |
| A0A1T2XC88 | 94-241 | None |
| A0A1T4P9U4 | 66-237 | None |
| A0A841T313 | 141-281 | None |
| A0A220MJ11 | 81-254 | None |
| A0A098MDP9 | 3-145 | None |
| A0A2M8ZAV2 | 6-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.