DPCstruct | MC8418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844U636 | 1-99 | MVVWSGRGILALIFFLIGCVVPRIVFGKEVSGELVFSIGTLLAGIATWVLGVLWNEEKILFHEEDNQYYRYKNNHTLFWIPMQYIGV… |
| A0A0F2QPE9 | 1-116 | MIVWSGWGILVLVFVVAAFFGDVSLVSFVAGAMGHGTPDAPPLIARLVGFLPWIGAAAAAWFMGRKVNTKTEKVLIDPETNEPVTLR… |
| A0A5C1AXP7 | 16-126 | None |
| A0A5N5Z8Z0 | 1-96 | None |
| A0A7X6BPF7 | 2-108 | None |
| A0A2N8BZ19 | 30-127 | None |
| A0A7T8YMK1 | 1-106 | None |
| A0A1Q9A0T2 | 27-140 | None |
| A0A7K1GAQ8 | 134-239 | None |
| A0A845MMT7 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.