DPCstruct | MC8415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 346 |
|---|---|
| Mean domain length (aa) | 169 ± 38 aa |
| Standard deviation of domain lengths | 38.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.57 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | CL0023- PF02898- CL0090- CL0105- CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A340XZ66 | 3-108 | LSPADKTNVKGTWAKVGNHGAEFGAEALERMFTSFPSTKTYFSHFDLGHGSAQIKGHGKKVADALTKAVGHIDNLPDALSELSDLHA… |
| A0A6C0SLH6 | 16-178 | VSREYQPLALTEKQKGLIEKTWKIVEEDIGMLKGGILLFMRIFELCPPALKLFKKFSDIPNEQLPENEDLQSHGLQVMETVALAVSS… |
| A0A820FWV0 | 2-131 | None |
| A0A673VTQ0 | 90-222 | None |
| A0A369KZF8 | 1-149 | None |
| A0A1D2NAV0 | 2-147 | None |
| A0A7S4SCM0 | 256-444 | None |
| A0A2B4SBA2 | 51-217 | None |
| A0A0N9HKT4 | 79-249 | None |
| A0A1M7NQ08 | 8-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.