DPCstruct | MC8413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8J307 | 154-239 | TFVPSGYVPSPVEPGWEIWLGFIAGVVPFAIGSYEFGKRILIQLRCEVCGGRGLVPSGGAGKDKYLRKCPQCGGFFPWISWQMFLS |
| A0A315AVC4 | 1-96 | MKKPSTKAWGVAAIHDVPVVADPTPVAITWQIVVGAIAGVTPFVVAGIEFSKRIIAQKRCEVCGGSGLVLTKEDYVKCPGCGGFLPW… |
| A0A822XPR7 | 1-134 | None |
| D7G800 | 30-121 | None |
| K8F2B3 | 29-159 | None |
| A0A383VMZ3 | 1-112 | None |
| A0A7J7M453 | 9-139 | None |
| A0A2V3IPJ8 | 9-114 | None |
| A0A0G4F8D4 | 43-157 | None |
| A0A0R0L3D7 | 43-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.