DPCstruct | MC8412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 470 ± 99 aa |
| Standard deviation of domain lengths | 99.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 98.68 |
| Assigned Pfam label(s) | PF01985- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315A552 | 46-553 | VKVKKAGVTQAVVDDIKFIWKTNELAMVKFDVPLCRNMHRAQEIVETKTGGMVVWRKKDTLVIYRGCNYQSSSKIFPKMRPCSADCQ… |
| A0A2K1R820 | 3-469 | WRTSELAMIKFYMPLCRNMNRARDIVEMKTGGLVVWTRKDIHVVYRGCNYQWKKNFNTATIEESFPRNGGEEESISAGILMEADLNT… |
| A0A811R6H7 | 153-714 | None |
| A0A4Y7JC41 | 136-818 | None |
| A0A166C816 | 166-770 | None |
| A0A383WCF8 | 221-585 | None |
| A0A6V7P370 | 1-478 | None |
| A0A803M4B2 | 155-534 | None |
| A0A803LTJ8 | 103-542 | None |
| A0A2U1NLU3 | 5-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.