DPCstruct | MC8411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 66.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2JAP3 | 1-69 | MPPEKRRAIWAIYVWCRRTDELVDGPQAKYTTPETLQKWHEHLEHLFKGHPVDDEDVALVDTLQRFPVE |
| A0A314ZKH2 | 1-85 | MLMIDVEKNSAYDRKKKGIWAIYVWCRRTDELVDGPNASHITPTALDRWESRLEDLFQGRPFDMLDAALSIQSTDFPLTFSHSKI |
| G7JA44 | 1-71 | None |
| A0A1R3IEI7 | 1-70 | None |
| A0A834WV74 | 11-78 | None |
| A0A2N9G3T5 | 417-487 | None |
| A0A446TTG0 | 1-69 | None |
| A0A7R9Y2Z6 | 142-210 | None |
| J9PEK2 | 124-192 | None |
| A0A097F6Z7 | 125-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.