DPCstruct | MC841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6E1B9 | 3-66 | GRTDMCLKCQNKEFSDYAKFCKMCGTPLLNTCTDEKCAKVNIPDAWHCEYCGAPTLFGSNGLLA |
| A0A7W2A7D4 | 7-77 | ETDDLGRLKQCAYCQEPNALEDDHEARHCIYCGYSLVNHCTNTNFCGKTVPPNAAYCPYCGTETHFLLSKL |
| A0A2A8BFD9 | 7-74 | None |
| A0A0R2FXM2 | 319-443 | None |
| A0A7V6KXG2 | 248-325 | None |
| A0A2X2W947 | 229-294 | None |
| A0A3D1RSL8 | 233-321 | None |
| A0A1V5M5A9 | 143-226 | None |
| A0A357AQS6 | 10-106 | None |
| A0A4P8A3Q2 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.