DPCstruct | MC8409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 109 ± 23 aa |
| Standard deviation of domain lengths | 22.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314ZGI9 | 4-102 | PGLATQTPSPSNIKFIEECKGRLHFGCGKQIVDTLIKEWYVSDSCCFQLVSIGESCHIALVNSALSGPLAKLNKFEALNKSAQIWNQ… |
| A0A7J9N3Y9 | 5-95 | ENDKIIKENNCATKIGLPCVLEAFLTIFKTGSIPHNCCCELVVLGKVCHLALVNRTLENPLFKYLNPATIIARSIQTWNNCLAWIES… |
| A0A218WRX2 | 23-134 | None |
| A0A7J9FLP0 | 2-68 | None |
| A0A5N5I1B5 | 26-113 | None |
| A0A7C9DFW3 | 1-113 | None |
| D7KC95 | 1-97 | None |
| A0A1R3KFV6 | 1-79 | None |
| A0A022R704 | 205-351 | None |
| A0A5D2L543 | 21-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.