DPCstruct | MC8406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 130 ± 23 aa |
| Standard deviation of domain lengths | 23.03 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0K7B9 | 6-109 | IHEIGEEEREKLNDVDYLTGNPLATDILLYAVPVCGPYNAVQSYKYHVKIVPGPLKKGKAAKTALNLFTHMPEATTREKELIKACTD… |
| A0A314ZFJ4 | 256-413 | HQDDSLHSHANVGVEDDPPDLDKSASELDKVTIEEDDIHEIGEEEKEKLNDVDYLTGNPLPSDILLYAVPVCGPYSSVQSYKYRVKI… |
| A0A7J6S2N8 | 1-125 | None |
| A0A183NEF4 | 192-307 | None |
| A0A0K9Q5Y6 | 382-517 | None |
| U6L4N7 | 377-521 | None |
| A0A287QMX7 | 49-185 | None |
| A0A7R9T210 | 48-203 | None |
| A0A067BED2 | 42-210 | None |
| A0A0B1TI25 | 665-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.