DPCstruct | MC8405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 58.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453D8I8 | 66-157 | EEKKRQREENKLMKEAIKAQKAEQKKYAKEKDEWESGKHALRSIVAEIDSTIIETGSVGGTLLTRFAEKGLKYRVQVNPIRGSILWK… |
| A0A314ZEM1 | 41-135 | MEENNLKKQQEKLQRAALKAEAEEMKKIQKEQQKWEKGKFAVKSIVAEIDIKVVELGSVGGNLLTRFAERGITYRITSNPIERSIVW… |
| A0A453D872 | 13-104 | None |
| A0A565BNH9 | 4-91 | None |
| A0A4S4D3G5 | 164-269 | None |
| A0A7J6V572 | 108-200 | None |
| A0A6I9U1Z0 | 1-95 | None |
| A0A453D837 | 140-242 | None |
| A0A287JI76 | 2-93 | None |
| A0A314ZMV6 | 41-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.