DPCstruct | MC8404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 8.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.72 |
| Pfam Score | 90.97 |
| Assigned Pfam label(s) | CL0684- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2KB36 | 253-375 | LIVTVKPRQKPYDVIKTFYDESKNYKRKAEKAKEALRDLEQRLKELVEKAVKLELKSKARIKRREWYEKYHWLITSNGFLVIGGRNI… |
| A0A314ZAG5 | 10-112 | MDDDEKTLPADKVEVDLALSAHANAQRWYELKKKQEKTVTAHEKAFNAAERNTRLQLSQERTVAIISHMHKVLWFEKFNWFISSENY… |
| A8JJA7 | 1-110 | None |
| B8LDR3 | 432-555 | None |
| A0A445IJK6 | 446-565 | None |
| A0A6I9YZ31 | 125-249 | None |
| B9HX64 | 81-176 | None |
| G3ILC4 | 105-229 | None |
| A0A2A2KMW0 | 209-332 | None |
| B7XPB4 | 178-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.