DPCstruct | MC8403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 52.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6LK04 | 1-133 | MEGKENITEYRDKLDKTLKSDDLCNVEFLKKLVENQLSKSSQHEDQEYSDNLVQKRTKEVANFIGMLRSTSGSVDEVSHNGWKIKHD… |
| A0A314ZA06 | 1-119 | MEKTQKITQYRERLDKTLASPNLTNKEALKLLVKKQLIRSSENEIGGCNENVIEEKTAEVSNLLDMLRSACIVDDKGLTTCETTSHP… |
| A0A2P2MCU0 | 7-126 | None |
| A0A2Z6PHP6 | 1-124 | None |
| A0A6J0MPC0 | 1-117 | None |
| A0A1R3HFU7 | 206-343 | None |
| A0A835LLK8 | 1-118 | None |
| A0A2N9GMD6 | 53-191 | None |
| A0A835RUU6 | 3-123 | None |
| A0A2N9I848 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.