DPCstruct | MC8401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 108 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QRF8 | 48-151 | QYGSQGLVDGRCPSRGESKPMDSRAQSLVLMNFFTTNPSQSWACGNNSAPLVSRLRTCYDAAGKRWPNFIAVDFYMRSTGGGAPLAT… |
| A0A314Z7H2 | 8-113 | NADGNGGMIAGSCPNRAESFPMNTTTKSLVLVNYFRDLPDVTQACKDNSDSLLRMVNTCSDAAGKRWPNFIAVDFYKRSDGGGAPRA… |
| A0A2M9LCE0 | 359-494 | None |
| A0A4S8IQJ5 | 502-616 | None |
| A0A4S8IER9 | 1-100 | None |
| A0A0D3DJH4 | 121-224 | None |
| A0A0D3DI40 | 1-106 | None |
| A0A7J0EJ40 | 158-248 | None |
| A0A446MZA8 | 123-236 | None |
| I3SUH4 | 5-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.