DPCstruct | MC840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1WTF6 | 1-125 | MLVNNSLFHLYTEKISSLPEHISKKNLLRPDFLLEKENGMEISYGPFDYLNPEAKIVKVGITPGWSQMMLSYAQARDSLRQGNSAEE… |
| A0A0S2S579 | 1-107 | MLSKEDLLVDDFLMERNGLLEMYYAPHNEYINPSAKVVIIGLTPGWRQMRIAIQEAKAGLEKGLSDEEVCRKAKEAAGFAGTTRIHL… |
| A0A3M1WSZ8 | 1-109 | None |
| A0A807WYN9 | 21-136 | None |
| A0A2X4WYS2 | 1-128 | None |
| A0A142BBW9 | 2-124 | None |
| A0A2E0Z103 | 1-122 | None |
| A0A6L5Z752 | 7-127 | None |
| A0A286T710 | 4-124 | None |
| X5WZ15 | 128-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.