DPCstruct | MC84
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D3DJF4 | 55-156 | AQLIEGHTFRDYINTYKDNAENAQISAVVNALGLNKELLMALMADSVTEKNLNNFGRFDALKATVDKAKAKIYLEKQDGVTLPPFKL… |
| R5NGP3 | 1-122 | MEVEAGITLRDYITRYAAREKNEQVDKLVDRLGVNRSVVEEFLAKRIDEANINEFGRFDVLRSSIDVQRAKAFFEQHDHKALPVFKV… |
| W4P4Q1 | 36-135 | None |
| A0A6N7SIY4 | 229-350 | None |
| A0A413W2X2 | 675-779 | None |
| J9F580 | 482-581 | None |
| A0A839JRP9 | 43-148 | None |
| A0A7X5IEP8 | 153-258 | None |
| A0A645G0X9 | 1-110 | None |
| A0A354GDZ0 | 114-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.