DPCstruct | MC8398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 2 aa |
| Standard deviation of domain lengths | 2.14 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S5ZND2 | 112-186 | AEQLNNIIGRGIGLDNTNASPSELAKMVLDEFHTNGLFTVTKNEDGSYGVQYTQLSKEDYDYAIGILNKLNEKGL |
| A0A2G0PKJ9 | 18-91 | MLNNRTGRQIGVANANTSIKDQAKVVLNQFHKEGLYVAKENASGFSVVKEKITDEQFSYMNSQYDRGDNAGFSP |
| A0A0J5IU42 | 433-512 | None |
| A0A374HQF0 | 1-76 | None |
| R5YHM5 | 310-384 | None |
| T0QBZ1 | 59-132 | None |
| A0A5Y3V6K7 | 57-136 | None |
| A0A1M7AHN5 | 3-77 | None |
| A0A2G0Q6Z2 | 1-74 | None |
| A0A5P2GER2 | 237-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.