DPCstruct | MC8397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5K478 | 18-93 | VWLTDEFGASHQGAVDVLLADGTVPGPVYFDTASGTGGRSVLQWSVYDGRHRRPRAAGLCAVCSCGWAGPQHALDW |
| A0A4V2SQU7 | 5-84 | EHDWTTVEFGTSHRGRPGAVLPDGSEPKPVVFDVESGTNFRETRNWQVYAGSTLSAPRATALRGACSCGWRGSGLHPIDW |
| A0A4S2V5M8 | 4-81 | None |
| A0A1H5K0E2 | 54-130 | None |
| A0A0F4J9K0 | 5-82 | None |
| A0A397RJQ7 | 5-81 | None |
| A0A8A6HBB3 | 4-81 | None |
| F3ZMV3 | 97-178 | None |
| A0A3D9LQB9 | 2-76 | None |
| A0A5P2A290 | 203-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.