DPCstruct | MC8396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 15.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7FXX5 | 9-146 | LSEALVAKTTRLLMGAVPSLDTDQAWELLIVAAGKNASMRQVHDFLSRHPDALRHGLSDSPLALGRLARLLVDLGVGDIVEPTCFDC… |
| A0A4R2PVD3 | 14-142 | PIGLITDLVADVEKELDPETIRAVVTTVAGGRAKSRTLAAALNCRPAPLGDGRSPAPRALGDLLIALRQAGAREISPPVCTECGKHL… |
| A0A7X0GV08 | 7-176 | None |
| A0A559TNU1 | 6-159 | None |
| A0A1V3XRL7 | 18-131 | None |
| A0A1V3Y003 | 18-150 | None |
| A0A1J5Q671 | 16-153 | None |
| A0A0P4RIW7 | 17-121 | None |
| W8GUD8 | 3-144 | None |
| A0A7V9EKV5 | 46-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.