DPCstruct | MC8394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 260 ± 37 aa |
| Standard deviation of domain lengths | 36.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5GJW2 | 3-186 | NRVRIESPDDLFADLGKRRNKGVYFCRVNGYNDTIHDIILRFHEAARQNGVIIEGKLQNPDNNNLAYYNEMMGMDFQLDAGFINQSL… |
| A0A174BKW0 | 1-317 | MDKKKTKTKILKEEVQNIIFPVEDGYIKGDIKNFNYEIVTLDCTEEDISASLDESIVVRPYFEYKNEKVKIPVFFTCIRGVYKDIGE… |
| Q97J76 | 536-796 | None |
| Q97EW3 | 10-321 | None |
| A0A828ZAV0 | 6-232 | None |
| A0A4S2AFZ1 | 8-236 | None |
| A0A1S9CSP9 | 3-227 | None |
| Q3EJE0 | 111-396 | None |
| A0A3D0YCE9 | 2-237 | None |
| A0A1V5GK19 | 325-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.