DPCstruct | MC8393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4FS83 | 189-260 | KPTELDAIGIVDSHLELLLVDPVGWEEEIEVVHLEILQEKMNNYIHFLESKQYVARYGDKFDKKVIHIKLQY |
| A0A242NXD7 | 1-82 | MSIEDTNKIDMIGILKNNESVISLGITDHLSWNDEINNHLFLLQEKINSYLRFIESGEIYESFPTDKGKVDFLIEIFFQYKI |
| A0A1I7EWR6 | 146-218 | None |
| B9XKD3 | 132-210 | None |
| A0A0Z8I4R5 | 89-160 | None |
| A0A3R9LHY9 | 194-270 | None |
| A0A8B6N140 | 194-270 | None |
| A0A7Y6VE00 | 93-167 | None |
| B6B950 | 1-83 | None |
| A0A7T7ALF8 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.