DPCstruct | MC8391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0266- PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8JU44 | 1-123 | MHVRPVAREKILNLTVPVFVDIREDDGRGSFSPIPRDNRCFKMRQGARKEIIVTIQPTNSKILNIERCFGVLICPGRNVPDRDLHLL… |
| A0A814C6Z4 | 1-179 | MTTNSTYSGGRAEKTGTTLDSNHTNSTDENEIYHILLSFANAIKTAARPSQTQVQPHSKSSNLLVKFRAHLDIKEHDGKGNFEFVQR… |
| A0A0R3S3G7 | 127-299 | None |
| A0A4Z2B5W3 | 212-361 | None |
| A0A5K3FEH7 | 147-315 | None |
| A0A0N5CMQ2 | 276-443 | None |
| A0A6I9PV68 | 1-155 | None |
| A0A815YXB4 | 269-408 | None |
| A0A402EIY6 | 381-571 | None |
| W2TCG4 | 158-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.