DPCstruct | MC8390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820X5E0 | 433-581 | GSSVQYIDDIFLASGGIAADNLKNKGQCMVLLLYAYLSGNKIQPGTSYTVFNESYTLKAKGLKLFEKLPTPSRRLANLINGMKDIDN… |
| A0A814C0V6 | 1-153 | MHNTLKHKGKAAKFVDDIFQPAENNLLSVKQNLNNKRRCMAMLLRDYLSEQPIPKLYTCYNHRYNLIKEAHQSFDTLAQQQKPSLLL… |
| A0A814GSV7 | 297-453 | None |
| A0A819EQT1 | 1-121 | None |
| A0A817LN66 | 637-796 | None |
| A0A817PCI5 | 790-949 | None |
| A0A817V4R5 | 754-888 | None |
| A0A819W3B6 | 914-1054 | None |
| A0A816AP63 | 69-203 | None |
| A0A816HXW3 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.