DPCstruct | MC839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 178 ± 24 aa |
| Standard deviation of domain lengths | 24.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 60.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J2PV28 | 7-194 | SLSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDSSTPSNSNTSNGEADSSRQSVSECKVW… |
| A0A6J3ARL9 | 1-163 | MGGTESSISDPGSPSSSKESETNRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLTYYDMNLSAQDHQTFFTCDTDFLRPSDTVM… |
| A0A2D4JWZ7 | 1-162 | None |
| A0A212CKB8 | 2-159 | None |
| F1R8L6 | 7-178 | None |
| A0A5E4C837 | 44-233 | None |
| A0A0N5ALE9 | 180-384 | None |
| A0A132AEF0 | 2-162 | None |
| A0A817CYK4 | 392-622 | None |
| A0A3P8X2N5 | 63-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.