DPCstruct | MC8387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 202 ± 35 aa |
| Standard deviation of domain lengths | 35.16 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813V979 | 144-320 | TSAAPSSSSTLRLPPGTRLNTNGNLLLISSGIQSLDSFIGGGFPVGSLILIYEDDDSSYLSDSILRCFLSDGVYSKHDLCISSMRTD… |
| A0A1J1HH82 | 1-210 | MSSFVKLKKDNAIDIKGVKTSLRNGQVTSSGCDSLDFVLGGGLEISSLFLVGEDKYARHSNILTRLFLADGFHHGHKIYFANIDNDP… |
| A0A2H2IH56 | 3-173 | None |
| A0A1J8PTC0 | 501-723 | None |
| A0A6A3AX29 | 1-255 | None |
| A0A843X1E7 | 51-206 | None |
| A0A0M3IX84 | 74-269 | None |
| A0A372QHR5 | 2-240 | None |
| A0A183ULA5 | 37-248 | None |
| A0A0R3S1R5 | 62-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.