DPCstruct | MC8385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 315 |
|---|---|
| Mean domain length (aa) | 150 ± 29 aa |
| Standard deviation of domain lengths | 29.38 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 12.49 |
| Pfam Score | 85.08 |
| Assigned Pfam label(s) | CL0609- PF19739- CL0059- PF19384- PF14926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1NAH3 | 193-315 | CALSNNRFCTVKTYKDESVVDLHESFEKGGEWIRKKGIRLTRGEWAALCAAMDEVTKACDVVSENDIDICDLSSLRKAKVGRYRGEV… |
| A0A813TVS7 | 8-156 | RPDNGDRQQAGEEELATKTLHVQSKRFYLDVKQNRRGRFLKIAEVSAGGRKSRILMSMNVASELRDHLQTFNEHLDTLGEPSPNNAP… |
| E8U684 | 272-435 | None |
| A0A847CDL9 | 27-179 | None |
| A0A0D2MPT8 | 6-136 | None |
| T1EDC4 | 4-186 | None |
| R7Q859 | 115-252 | None |
| A0A2M8TZV0 | 1-123 | None |
| A0A2L2MPA4 | 1-122 | None |
| A0A6V7TWS7 | 50-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.