DPCstruct | MC8384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF02936- PF04113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813TS20 | 208-305 | YEVDNYKEELYIRPLQSGHTYFQFLFTTVVDNDIIENNIVHHYNLFPKSIADLIRLNSIDEFHISLTQGLWRYKQWNFPIVSAPPGA… |
| A0A0H5QNA9 | 38-132 | VLAFDDGEQFRERLLIRPLPDHNVLLHFDFNMTIDRLLDPDDEHYRFFPKSIAQIITKHQVGEFVLKLTQGRWRYAHWGLPVVPAPT… |
| A0A7M4ED73 | 5-119 | None |
| A0A060WTA1 | 132-217 | None |
| A0A2J8MK44 | 7-123 | None |
| T1GKT3 | 2-117 | None |
| A0A553MLK0 | 72-179 | None |
| A0A1W2PQ29 | 8-122 | None |
| A0A498LTZ6 | 86-186 | None |
| A0A2H2IML0 | 10-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.