DPCstruct | MC8383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 8 aa |
| Standard deviation of domain lengths | 7.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540L4Y8 | 107-241 | FKQLFHHPLLQSTTERFRFPTRAVLKFKYNRKENWEQEYERFNKREVNFDSQIQKSIYKDAFKLLLNHEGTGYKNTVVDVLRFSKNA… |
| A0A251QMN4 | 66-219 | QRLFDFKQLQWHPLLFPSTAKPKLVYNVFSYLGLEETLSWKKDFRQMIQRDVEVRDTVLGVDVDYFSHVYNLKGPQYYVENALGAFL… |
| A0A498K9T2 | 456-595 | None |
| A0A6P5SCU6 | 168-308 | None |
| A0A5E4GKF4 | 412-551 | None |
| A0A7N2MWS0 | 80-239 | None |
| A0A314ZKD1 | 5-150 | None |
| A0A314Y1J9 | 1-153 | None |
| A0A314XTV6 | 315-459 | None |
| A0A5H2XVU5 | 103-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.