DPCstruct | MC8382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 370 ± 59 aa |
| Standard deviation of domain lengths | 59.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 82.11 |
| Assigned Pfam label(s) | PF06978- PF08170 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251PTD1 | 21-331 | SAMLHHLGAPFSTPIAPVTYMWRPSGQPSDGCNGLEGTENSSTFRQLWVWIHASVLTEAYHTLKLACQKEMDNRGILINCISLEGQL… |
| A0A0N4YII4 | 254-675 | VDRWGYRLPDRSFQRNFRPCYRDSVRHCTVRDKSYLSCFLISHDNQDELISALSPLCANASSPTFAFKSGRTGKYEVSTLIFQPGQY… |
| A0A2K1L0H3 | 221-666 | None |
| A0A061DBK3 | 199-555 | None |
| A0A7I4D5U9 | 16-316 | None |
| A0A3F2RXZ2 | 485-843 | None |
| A0A175W6B4 | 243-701 | None |
| A0A4Y9Y9P2 | 2-294 | None |
| A0A816CNH3 | 412-810 | None |
| A0A7S0R8G3 | 1-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.