DPCstruct | MC8380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 357 ± 85 aa |
| Standard deviation of domain lengths | 84.53 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 60.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8W3W8 | 1-203 | LPRTNFKVKFSLEIKKGGGPKSQFYLLDIGSCWKNNGKPCDGDVLTDVTRYSEMIINPDVPVWCSPTQLVNCPPYHITPNNTKILRN… |
| A0A251PGS4 | 21-389 | AEKELYLGFKCQVEDTPNPWQFWMIMLKSGNMDTYAAKCPKNGHRVGPFPDQNTFPCFGKGCMNQPSIYHDYTKLQLPDMTLKGRFF… |
| A0A835ARK9 | 290-735 | None |
| K4A240 | 74-441 | None |
| A0A6P5FNP2 | 70-500 | None |
| J3M5F3 | 48-533 | None |
| A0A0D9ZWJ7 | 243-492 | None |
| A0A834LLT3 | 428-847 | None |
| A0A5N5GEN4 | 43-389 | None |
| A0A2R6XK68 | 182-627 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.