DPCstruct | MC838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 3.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 81.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1NCE3 | 79-144 | KCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRLWQ |
| A0A674NS11 | 60-128 | QTVKCSCFPGQVAGTTRAMPSCVDASIVAQKWWCQMQPCMEGEECKVLPDLTGWSCSTGNKVKTTKVTR |
| A0A2R8QI81 | 50-113 | None |
| A0A2R8Q4E5 | 51-115 | None |
| A0A4W4DWN6 | 58-125 | None |
| G3IDS6 | 61-124 | None |
| A0A674KCA0 | 52-120 | None |
| A0A2D0TBC5 | 38-101 | None |
| A0A3Q4H140 | 54-118 | None |
| A0A822EVX7 | 30-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.