DPCstruct | MC8377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 180 ± 39 aa |
| Standard deviation of domain lengths | 38.60 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1KRU7 | 23-163 | MNLDEFLIENGVDSKYMDTMQKESKVEVEFSPLDIALATRPGSDANFDPSSARFSEDELRPQPIMRKSRKQHVPDTLKDARYWARRV… |
| A0A1I8QE13 | 31-197 | LNVSKTQDSLMDEANLLQTVSPAGLTLPNINILPLPGSSAALLNSTSQPALPAFEYLTPAARNLSPVDFPLMELNRVGSMFPAFLHR… |
| A0A6P8T781 | 249-406 | None |
| A0A7J8CFD8 | 3-178 | None |
| A0A7R8XCK1 | 1-133 | None |
| A0A034VGA9 | 241-458 | None |
| A0A6P4T3Q0 | 1-206 | None |
| A0A2C9JJ10 | 294-423 | None |
| A0A2P8Z692 | 1-170 | None |
| A0A834N3P8 | 43-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.