DPCstruct | MC8376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 174 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 62.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04201 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9GN36 | 4-150 | SFMNLSLEEQEIKKEEWRKELAEVEYEIQTMRQVLTSKLRKSSELKRKLGITAWGEFSNDISQGLRNVKETSTFQTIEEKVEEVSKA… |
| A0A1I8Q6V4 | 1-175 | MEELYNTGNTSPAASVASADIAAEFAALTVEEQERQRAEWSQELARVEEEINTLRTVLASKTRHASDLKRKLGITVWKEITDDMNQG… |
| A0A267G2D2 | 9-198 | None |
| A0A1L8EEJ5 | 1-177 | None |
| A0A6P4F7B2 | 4-160 | None |
| T1KU26 | 5-211 | None |
| A0A6I8VFP8 | 69-240 | None |
| C1BQ62 | 9-182 | None |
| A0A1J1IT97 | 178-339 | None |
| A0A0P8XMT2 | 4-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.