DPCstruct | MC8375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8V5C8 | 32-88 | SIELRAGKLYPTCDCIKRNGLQSDCRRTECQGKSCCMRKSGPTCSPASFAQRLANHN |
| A0A1I8PUG2 | 15-97 | CEPCCPPSQPKSCQSHELRAGIMYSTCDCFRRNGLQDKCPRALCQGRSACMSFPKPNCCPSKFPLRFANMTMGVRKRSGNACS |
| A0A1B6E8W8 | 104-192 | None |
| A0A7E4RN03 | 84-151 | None |
| A0A482V452 | 87-158 | None |
| B4LRR0 | 2-77 | None |
| A0A194PPZ2 | 50-122 | None |
| A0A4P6D7N1 | 8-71 | None |
| A0A7J6ZSG6 | 72-156 | None |
| A0A2R7W6K9 | 120-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.