DPCstruct | MC8372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 216 ± 21 aa |
| Standard deviation of domain lengths | 20.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1MN67 | 32-226 | EPLDGIRTRCWYESLKQRFAFSGPAEMERHLEPDAVKWHADGRFNYSSNKWPRFRDGSPPGARTLEKVEKNAPGSMRIFYHPLWDVL… |
| A0A7Y4W3L8 | 76-285 | MTSRYVEDIEIRQLRVRTWVRAVRLASDLSLIELERQFSDSKTKAKAPRSCIWDKYAKGDVAPRMGKKPNGKLHLANRIDKAYPGTL… |
| A0A2C9BAA4 | 1-244 | None |
| A0A6H2CCE2 | 6-260 | None |
| A0A381EY20 | 52-301 | None |
| A0A380AD43 | 7-216 | None |
| A0A0S7ZL17 | 41-258 | None |
| A0A6H3T7E4 | 2-237 | None |
| A0A2N2VKV6 | 11-222 | None |
| A0A7H8VCC2 | 26-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.