DPCstruct | MC837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 57.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8V6S8 | 62-126 | TSRVWCYPVENILCDGKVHNGSTRGFQMTVPCKWTNGKRFDTALLFSIFLGMLGVDRFYLGYSAI |
| A0A6J2PHY2 | 1-76 | MTAWVECLPAPNISCRLSNGTEFRFSGEEVGFNKTIPCRNVSGYSYKVAVALSLFLGWLGADRFYLGYPALVRPTT |
| A0A6I9Z2V1 | 58-137 | None |
| A0A287D890 | 7-89 | None |
| A0A553R986 | 80-147 | None |
| A0A4Z2D7I1 | 64-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.