DPCstruct | MC8368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E3I2Z6 | 4-52 | HGHYCKVCGEYKANEKFSGKGHAAHICKSCASLPPEKQAEQMTVNRLLN |
| A0A3D0NZV7 | 1-57 | MKKRKYQGHYCKICGRRKSNEKFSGSGYTAHICRDYAKLPKEKRDDMQTIVEDKVNL |
| A0A3D1GYE9 | 6-64 | None |
| A0A136Q6X9 | 103-155 | None |
| R9KM72 | 1-53 | None |
| G1VEX8 | 4-50 | None |
| A0A2N9P059 | 1-48 | None |
| A0A2V3JP56 | 3-58 | None |
| A0A644UM10 | 1-56 | None |
| R9LGA1 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.