DPCstruct | MC8367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D1KEA1 | 6-118 | ILAGLRRPDDIPGLLLEVPVDQVPPDLALPRSNGFIVETVLLGSGHAGTVRFSLALTDRSYGAVFTVLCEDVADAAAAASTPRLALR… |
| A0A3D0NWT2 | 1-158 | METLNTAFESFAAPETYHRVDGTHPLDLYIGVDEHLRWSLMLITDSEPPAVTPSRMISSQKRQRTDGRWTLTLSLTDNAYKDIFLLF… |
| A0A6G8UEA6 | 4-118 | None |
| A0A2E0RS30 | 1-181 | None |
| A0A6M6I6V1 | 7-155 | None |
| A0A7K1J7G4 | 1-200 | None |
| A0A0K8Q097 | 15-173 | None |
| A0A2U0SDF1 | 2-149 | None |
| A0A3D4G9B4 | 7-138 | None |
| A0A255EBC4 | 60-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.