DPCstruct | MC8363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 59 ± 7 aa |
| Standard deviation of domain lengths | 6.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6D7T5 | 1-58 | MSDYPPVVAMAEMTSMLGISRSRLVQLLVTSEFPNPIATLTVGRIWSTKDVEAYAQQT |
| A0A3D0S2S0 | 1-52 | MGVTEIAAMLGVSGQRVSQLSRTRAFPEPVAELAAGRVWLRADVEKWARETG |
| A0A2T0JIA6 | 1-55 | None |
| A0A2X3L7S1 | 1-54 | None |
| I0H733 | 6-56 | None |
| A0A0M8W950 | 2-60 | None |
| G8SJ32 | 18-75 | None |
| A0A2W4NC62 | 4-65 | None |
| A0A1V2IKH4 | 2-57 | None |
| A0A0U3QDV6 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.