DPCstruct | MC8361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9A8L1 | 1-70 | MKDDDIDYSDIPELDADFFATARVVVPPGKKQVTVRLDRDVLAWLKAQGRGYQTRINAILRAYYEAHASR |
| A0A3E0LU54 | 15-83 | MKDEDIDTSDIPPLSEDFWVNAQLRLPKDIVTVKVEIDPETFAWFQSQGETAQEQMSVALKIYAQANKA |
| A0A0K1S577 | 1-71 | None |
| E0UC41 | 14-83 | None |
| A0A1G0YC13 | 10-81 | None |
| A0A6M9D489 | 50-124 | None |
| A0A0P4V2D7 | 1-66 | None |
| A0A1G0N470 | 8-81 | None |
| A0A1R4HE12 | 1-88 | None |
| A0A7C3G1V0 | 20-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.