DPCstruct | MC8359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 635 ± 114 aa |
| Standard deviation of domain lengths | 113.93 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 94.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.22 |
| Pfam Score | 86.36 |
| Assigned Pfam label(s) | PF02013- CL0220- CL0159- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8LEM6 | 1-493 | MYQMHWLMDVDNVYGFGRCGDRTTKPAYINTYQRGPQEGVFETVPHPSCETFNFGRTGNGGYLPIFIGDSTYTQQWRYTSAPDADAR… |
| R7MIV5 | 1-601 | MIPETQTGFWKQSKLSAQYAPEYETPEQYPAAQDPSNTGENPLFSAFKSAYSSDDGLYLLHWLADVDDWYGYGGSKKGELGSFTFIN… |
| A0A7V4QPP1 | 2-789 | None |
| P22534 | 1095-1740 | None |
| A0A1M7LFW9 | 33-784 | None |
| A0A5M3XN99 | 456-1101 | None |
| A0A160NU65 | 178-806 | None |
| A0A1V5MMV9 | 2-368 | None |
| A0A078KQR7 | 29-731 | None |
| A0A5M3XER1 | 110-735 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.