DPCstruct | MC8357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A1P0D9 | 15-92 | GTWEGSLGQDQLTRASALIGLFKGLHLLFANDMADRWPKLENRAPVFDRRSPIQAMIEGGIPRMLETRQYIDALRGGL |
| A0A091B1E8 | 1-74 | MLTEDVLERISYVLGIYQALHVLFVVPAQADEWIKRANAAALFAGGSALDRMLGGQMSDLSAVRQYLDSQRGWG |
| A0A091AVK9 | 3-63 | None |
| A0A521N9G6 | 66-140 | None |
| A0A7U8K7A0 | 1-84 | None |
| G6EF15 | 36-111 | None |
| A0A368K255 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.