DPCstruct | MC8354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 139 ± 30 aa |
| Standard deviation of domain lengths | 30.33 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8L337 | 1-86 | MDPFSNNPSLHKVFVTSFSKAQEQGIVPVGYGICEDEWENGVYPSFYHIRSGRKAGKELLVQLPDSIWQPRALAWAQAIDIYHNII |
| S8FFF8 | 70-208 | DDWVEAWNAHAVSGRHHNNTPSVNSDDLVARIIADQESNIRHAPIKVARHANPFQDEASEETFWTVFNGAWDLAPASLPNHLKLHDA… |
| A0A0D2Q4D5 | 330-423 | None |
| A0A0C9UDB0 | 26-150 | None |
| A0A4Y9ZSJ5 | 152-301 | None |
| A0A4Y9Y1N1 | 111-240 | None |
| A0A4S8LHZ8 | 2-174 | None |
| A0A0D7AWN6 | 20-235 | None |
| J0WP09 | 2-114 | None |
| A0A4S8LU03 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.