DPCstruct | MC8352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 172 ± 27 aa |
| Standard deviation of domain lengths | 26.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09485 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1QI79 | 5-143 | VGREAGSVPEMWGFYRMLTATGRASEKLQAEHTALTLYAVHQQSISDSMHRPGVGLGRALLRLRQSGTFSVDAVDRRFNAAATATSL… |
| I0HLZ5 | 4-170 | HANAFVQHLQSLALRDRGAIAALRRSLAFAPGTYPPAYPAVERFAAQGEDREAARRALYLCAGLFALHPAHASGRALATGLGETLIR… |
| A0A7Y4UHJ3 | 2-161 | None |
| A0A857M431 | 18-203 | None |
| A0A176YFN1 | 5-201 | None |
| A0A212U5Z0 | 12-188 | None |
| A0A415ZRG1 | 190-403 | None |
| A0A522S9M7 | 46-209 | None |
| A0A542XTH8 | 28-188 | None |
| A0A5V3YDY3 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.