DPCstruct | MC8350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 197 ± 10 aa |
| Standard deviation of domain lengths | 10.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3GU09 | 73-265 | GHEGEDRGRPARVEVVELLVPGLGPVDRERLIRPPATVGRVSGDEKAGLYRTVVDLNKAPHKVVREVYDWTRLTIGGASRALWLFLM… |
| A0A4D4KT83 | 47-225 | DLELLVHGVGGTTPEEMLGDPRTSLVTGDETAAVYRRADDIDAEQRPPEDREGPDRDGPIREAYVWCNLTSGNSSRALWLLLLPFMV… |
| A0A2P2CFD2 | 13-225 | None |
| A0A1C6SH41 | 1-190 | None |
| A0A0S9BZA7 | 7-214 | None |
| A0A3N5A116 | 293-489 | None |
| A0A7J5CL53 | 6-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.