DPCstruct | MC835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2CSQ2 | 23-98 | TRFIDYRYFAIITEGHPLNDPQAVVRQWKENGAFKEEQYVIGLKWEPSDLIRQQDVQAVPIDAYAVDVFKFTQLKR |
| A0A7C9RMI7 | 4-79 | KYRYYALIGVPDTLDDPHAVVRVGGEFDESFTTNLEWARTDLMNRIEWGRDDYEVVEISEKDAKRFEKTQARRVAE |
| A0A229T068 | 176-270 | None |
| A0A3D5DQS1 | 2-82 | None |
| A0A561U4H1 | 117-194 | None |
| A0A7W7MIM7 | 61-161 | None |
| A0A6N7I9J4 | 1-82 | None |
| A0A6N7IA13 | 1-69 | None |
| A0A7Y4V213 | 90-185 | None |
| M2QKW6 | 324-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.