DPCstruct | MC8349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M7RMH7 | 2-69 | STIIDAEALFVSALQPSDLPTPEQVRAAIAGALLTCGGADGCAVRLAAEFGEHPETAVARMQWAIQTL |
| A0A2P8B3K7 | 7-77 | ASIRAEALFVSDLQASEDPAPAQIRAVILRSLGQHRTAGCAALVAQEYGDHPSEAVERMRWAVAAVRTAYA |
| A0A810L4I7 | 21-94 | None |
| A0A6F8Y863 | 1-78 | None |
| A0A1Q9TY78 | 10-77 | None |
| A0A5M3WJ36 | 51-127 | None |
| A0A7W7MDQ0 | 48-142 | None |
| A0A7X0NZY7 | 1-77 | None |
| A0A6F8YV66 | 33-106 | None |
| A0A7W7CMJ4 | 6-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.